PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS59700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 135aa    MW: 15256.4 Da    PI: 10.4781
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS59700.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.65.7e-1359103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
       EPS59700.1  59 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 103
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.98E-1753109IPR009057Homeodomain-like
PROSITE profilePS5129414.1854108IPR017930Myb domain
TIGRFAMsTIGR015573.2E-1957106IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-657109IPR009057Homeodomain-like
SMARTSM007176.5E-1058106IPR001005SANT/Myb domain
PfamPF002491.1E-1059103IPR001005SANT/Myb domain
CDDcd001671.04E-861104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 135 aa     Download sequence    Send to blast
MVSVNVNPPP EGFFLDTTGM ALPNLSSFSP PAAGNNNTTA QIEDPSKKVR KPYTITKSRE  60
SWTEPEHDKF LEALQLFDRD WKKIEAFVGS KTVIQIRSHA QKYFLKVQKS GTQEHLPPPR  120
PKRKAAHPYP QKASK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00560DAPTransfer from AT5G52660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076101.15e-78PREDICTED: protein REVEILLE 6-like isoform X1
RefseqXP_011076102.14e-78PREDICTED: protein REVEILLE 6-like isoform X2
SwissprotC0SVG52e-63RVE5_ARATH; Protein REVEILLE 5
TrEMBLS8BYN59e-97S8BYN5_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0017s01140.12e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9982478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01280.26e-52MYB_related family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]